Released on: February 12, 2008, 10:52 am

Press Release Author: AnaSpec Inc.

Industry: Biotech

Press Release Summary: This week AnaSpec, one of the world's largest providers of
custom and catalog peptides, introduced thirty-six (36) new catalog peptides.

Press Release Body: February 12, 2008 - San Jose, CA

This week AnaSpec, one of the world's largest providers of custom and catalog
peptides, introduced thirty-six (36) new catalog peptides.

Beta-Amyloid (1-40) Binding Peptide- Cat# 62426
This 20 amino acid peptide binds to the amyloid form of beta-Amyloid (1-40) but not
to monomeric beta-Amyloid (1-40). This sequence represents new potential carrier
molecules to deliver medicines to amyloid plaques in AD patients and to image
plaques in AD brains. The ability to directly target reagents to the amyloid form of
the beta-Amyloid peptide may allow the delivery of neuroprotective agents to make
amyloid plaques less toxic, the delivery of amyloid-destroying molecules to
eliminate plaques, or the delivery of reagents to prevent amyloid plaque formation.
Sequence: DWGKGGRWRLWPGASGKTEA

Beta-Amyloid (1-40) Binding Peptide, biotinylated- Cat# 62427
This 20 amino acid peptide binds to the amyloid form of beta-Amyloid (1-40) but not
to monomeric beta-Amyloid (1-40). This sequence represents new potential carrier
molecules to deliver medicines to amyloid plaques in AD patients and to image
plaques in AD brains. The ability to directly target reagents to the amyloid form of
the beta-Amyloid peptide may allow the delivery of neuroprotective agents to make
amyloid plaques less toxic, the delivery of amyloid-destroying molecules to
eliminate plaques, or the delivery of reagents to prevent amyloid plaque formation.
This sequence is biotinylated on the N-terminus.
Sequence: Biotin-DWGKGGRWRLWPGASGKTEA

Beta-Amyloid (1-20)- Cat# 62456
This is amino acids 1 to 20 fragment of the beta-Amyloid peptide.
Sequence: DAEFRHDSGYEVHHQKLVFF

Biotin-LC-beta-Amyloid (1-16)- Cat# 62458
This is amino acids 1 to 16 N-terminal fragment of the beta-Amyloid peptide,
biotinylated through an LC spacer.
Sequence: Biotin-LC-DAEFRHDSGYEVHHQK

Biotin-beta-Amyloid (1-15)- Cat# 62461
This is amino acids 1 to 15 fragment of beta-Amyloid, labeled with Biotin at the
N-terminus.
Sequence: Biotin-DAEFRHDSGYEVHHQ

Beta-Amyloid(15-26)-Lys(Biotin)-NH2- Cat# 62469
This is amino acids 15 to 26 fragment of the beta-Amyloid peptide biotinylated
through the side chain of Lys at position 27.
Sequence: QKLVFFAEDVGS-K(Biotin)-NH2

Beta-Amyloid (11-28)-Lys (Biotin)-NH2- Cat# 62472
This is amino acids 11 to 28 fragment of the beta-Amyloid peptide biotinylated on
the side chain of lysine.
Sequence: EVHHQKLVFFAEDVGSNK-K(Biotin)-NH2

Beta-Amyloid (1-40), DAC-labeled- Cat# 61949-01
This is amino acids 1 to 40 sequence of beta-Amyloid, labeled with DAC. beta-Amyloid
(1-40) together with beta-Amyloid (1-42) are two major C-terminal variants of the
beta-Amyloid protein. These beta-Amyloid peptides undergo post-secretory aggregation
and deposition in the Alzheimer's disease brain. This peptide is labeled with DAC,
an excellent blue fluorescent dye.
Sequence:
(7-Diethylaminocoumarin-3-yl)carbonyl-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Innate Defense Regulator-1 (IDR-1)- Cat# 62514
This peptide is an innate defense regulator (IDR-1). IDR-1 acts through
mitogen-activated protein kinase and other signaling pathways, enhances levels of
monocyte chemokines while reducing pro-inflammatory cytokine responses. IDR-1
counters infection by selective modulation of innate immunity. It is protective
against Gram-positive and Gram-negative pathogens in mouse models of infection.
Sequence: KSRIVPAIPVSLL

Mundticin KS- Cat# 61917-05
Mundticin KS is a bacteriocin produced by Enterococcus mundtii NFRI 7393 isolated
from grass silage (Thailand). It belongs to the mundticin family of mundticin KS
(mun KS) and mundticin AT06 (ATO06) peptides known to be active against several
strains of Enterococcus spp, Lactobacillus spp., and Listeria monocytogenes.
Sequence: KYYGNGVSCNKKGCSVDWGKAIGIIGNNSAANLATGGAAGWKS (Disulfide bridge: 9-14)

NOXA BH3, Peptide 2- Cat# 62403
This NOXA peptide belongs to the group of inactivator BH3-only molecules. NOXA and
other BH3-only molecules differentially inactivate members of the anti-apoptotic
Bcl-2 family. NOXA specifically antagonizes Mcl-1 molecule.
Sequence: VPADLKDECAQLRRIGDKVNLRQKL

PUMA BH3- Cat# 62404
This is a PUMA (p53 upregulated modulator of apoptosis) BH3 domain peptide. PUMA
together with Bcl-xL, and cytoplasmic p53 coordinates p53 functions. PUMA proteins
bind Bcl-2, localize to the mitochondria, and induce cytochrome C release and
apoptosis in response to p53. PUMA may be a direct mediator of p53-induced
apoptosis.
Sequence: EEQWAREIGAQLRRMADDLNAQYER

BAD (CT-1)- Cat# 62271
This is a C- terminal sequence derived from the pro-apoptotic protein Bad, the death
agonist.
Sequence: KKGLPRPKSAGTATQMRQSSSWTC-NH2

Bad (103-127), human, all d-isomers- Cat# 62322
This is amino acids 103 to 127 fragment of the Bad analog, the BCL2-antagonist. This
fragment is composed of all d- amino acids. It is predicted to induce extensive
apoptosis of breast cancer cells.
Sequence: nlwaaqrygrelrrmsdefvdsfkk

BH3 BIM Peptide (52-71), human- Cat# 62439
This amino acids 52 to 71 fragment of the BH3 domain of Bim that reportedly
functions as direct
Sequence: Ac-MRPEIWIAQELRRIGDEFNA

HB-1 (26-41)- Cat# 62511
This peptide, amino acids 26 to 41 fragment of B-cell leukemia-associated antigen
HB-1, is a minimal polymorphic tumor-associated antigen (TAA) recognized by CD4+
clones from donors with B-cell acute lymphoblastic leukemia (B-ALL). HB-1 is able to
induce both CD4+ Th and CD8+ CTL responses, implicating that HB-1 is a suitable
target for B-ALL-specific immunotherapy.
Sequence: EDDVYLRHSSSLTYRL

BAFF-R (160-183)- Cat# 62523
This is amino acids 160 to 183 fragment from the cytoplasmic domain of B
cell-activating factor (BAFF), belonging to the TNF family receptor (BAFF-R). It
plays a role in autoimmunity after ligation with BAFF ligand (also called TALL-1,
BLyS, THANK, or zTNF4). BAFF/BAFF-R interactions are critical for B cell regulation.
Signaling from this ligand-receptor complex results in NF-kappa B activation.
Sequence: SVPVPATELGSTELVTTKTAGPEQ

Alpha B-Crystallin (73-92)- Cat# 62411
This peptide is amino acids 73 to 92 fragment of alpha B-crystallin. It is involved
in preventing the formation of light scattering aggregates by substrate proteins.
Within this sequence, amino acids 84 and 86 are essential for alpha B-crystallin to
effectively prevent the aggregation of substrate proteins. This peptide is involved
in chaperone-like activity.
Sequence: DRFSVNLDVKHFSPEELKVK

TAT-NSF700 Fusion Peptide- Cat# 62238
This peptide is the N-Ethyl-maleimide-sensitive factor (NSF) inhibitor fusion
polypeptide composed of 11-amino acid cell permeable HIV transactivating regulatory
protein (TAT) domain fused to a 22 amino acid NSF domain. TAT-NSF700 inhibits
thrombin-induced exocytosis of endothelial cells in a dose-responsive manner.
Sequence: YGRKKRRQRRR-GGG-LLDYVPIGPRFSNLVLQALLVL

Lipid Membrane Translocating Peptide- Cat# 62397
This is an all d-amino acids sequence of the lipid membrane translocating peptide.
It is a drug delivery peptide that is able to penetrate the lipid membranes.
Sequence: KKAAAVLLPVLLAAP

Leptin (57-74)- Cat# 62521
This peptide is amino acids 57 to 74 fragment of leptin. It modulates body mass and
food intake in animals.
Sequence: VTGLDFIPGLHPILTLSK

Insulin Growth Factor Binding Protein 6 (IGFBP6 ), mouse- Cat# 62418
This octapeptide belongs to the mouse insulin growth factor (IGF) binding protein 6
(IGFBP6). There are 6 well-characterized IGFBPs. They are not only carriers of IGFs,
but also modulators of their activity. IGFBPs are also important in cell growth.
Sequence: GPSEETTK

Link N- Cat# 62518
This peptide is cleaved from the N-terminus of the link protein component of
cartilage proteoglycan A by stromelysins 1 and 2, gelatinase A, B, and collagenase.
It aggregates by the action of stromelysin. This peptide can act as a growth factor
and stimulate synthesis of proteoglycans and collagen in articular cartilage.
Sequence: DHLSDNYTLDHDRAIH

HIV-1, Envelope Glycoprotein (187-203)- Cat# 62435
This amino acids 187 to 203 fragment is derived from the V3 loop of the HIV gp120
envelope protein.
Sequence: RGPGRAFVTIGKIGNMR-NH2

Preptin, Human Pro-Insulin Growth Factor II (69-80), human- Cat# 62430
This sequence belongs to the human preptin. Preptin is a recently isolated 34-amino
acid peptide hormone that is co-secreted with insulin and amylin from the pancreatic
beta-cells. Preptin corresponds to Asp69-Leu102 of pro-insulin growth factor II
(pro-IGF-II). Increased circulating levels of a pro-IGF-II peptide complexed with
IGF-binding protein-2 have been implicated in the high bone mass phenotype observed
in patients with chronic hepatitis C infection.
Sequence: DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL

Apolipoprotein J (215-222)- Cat# 62516
This peptide is amino acids 215 to 222 fragment of apolipoprotein J. This sequence
is virtually homologous with the cytolysis inhibitor SP-40,40, and may have an
inhibitory effect on complement-mediated cell lysis. Apolipoproteins may be involved
in the progression of focal segmental glomerulosclerosis (FSGS), as well as other
forms of noninflammatory glomerulonephritis.
Sequence: RPHFFFPK

Apolipoprotein L (306-316)- Cat# 62517
This peptide is amino acids 306 to 316 fragment of apolipoprotein L that has been
isolated from pancreatic exocrine cells. Apolipoproteins play a role in the
pathogenesis of focal segmental glomerulosclerosis (FSGS) and other glomerulopathies
in vivo. FSGS serum may be deficient in particular apolipoproteins that normally
bind and protect the glomerular basement membrane against the putative permeability
factor or its effects.
Sequence: VNEPSILEMSR

epsilon-V1-2, epsilon-PKC Inhibitor, Cys-conjugated- Cat# 62187
This peptide is the epsilon-PKC specific inhibitor. Its inhibitory activity is based
on epsilon-PKC translocation and MARCKS phosphorylation. This peptide interferes
with epsilon-PKC interaction with the anchoring protein epsilon-RACK. This sequence
contains a cysteine residue added on the C-terminus.
Sequence: EAVSLKPTC

TRBP, Thyroid Hormone (TR)-binding Protein, biotinylated- Cat# 62287
This peptide is a fragment of the thyroid hormone (TR)-binding protein (TRBP), the
LXXLL motif, containing the Ser884 phosphorylation site, is a key residue for
receptor selectivity. This peptide interacts with nuclear receptors, and
ligand-dependent interaction of nuclear receptors and co-activators is a critical
step in nuclear receptor-mediated transcriptional regulation. The LXXLL-binding
affinity correlates with TRBP transcriptional activity.
Sequence: Biotin-KDVTLTSPLLVNLLQSDIS

ERK 1/2 /MAP Kinase Substrate, FAM labeled- Cat# 62342
This is a mitogen-activated protein (MAP) kinase substrate, also designated as
peptide 4. This peptide is labeled with FAM at the N-terminus. It may be used to
determine activation of p38, a member of MAP kinase family which acts as a switch
for the transcriptional and translational regulation of a number of proteins,
including the proinflammatory cytokines. IPTSPITTTYFFFKKK is also known as an ERK1/2
substrate.
Sequence: 5-FAM-IPTSPITTTYFFFKKK

Glycogen Synthase Kinase 3 alpha (GSK3a) (16-26), phosphorylated- Cat# 62354
This peptide belongs to the amino acids 16 to 26 fragment of glycogen synthase
kinase, and is phosphorylated at Ser21.
Sequence: RARTS-pS-FAEPG

Dominant H2-Kd Ligand- Cat# 62510
This peptide is a dominant H2-Kd ligand derived from the JAK1 tyrosine kinase. MHC
ligands can be generated directly by the proteasome in vivo. The expression of the
corresponding MHC molecule for this ligand is critical for its protection.
Sequence: SYFPEITHI

Inter-alpha-trypsin inhibitor heavy chain 4, C-terminal fragment (H4CT)- Cat# 62252
This peptide is a proteolytically derived C-terminal fragment from the proline-rich
region (PRR) of human inter-alpha-trypsin inhibitor heavy chain 4 (ITIH4). The
fragmentation patterns within the PRR of human serum ITIH4 are associated with
different cancer disease conditions and may hold important diagnostic information.
This sequence contains a cysteine residue added on the C-terminus.
Sequence: CLGLPGPPDVPDH.

Eukaryotic Translation Initiation Factor,4E b- Cat# 62372
This peptide is an eukaryotic translation initiation factor 4E b, known as eIF4b.
The integrity of eukaryotic translation initiation factor (eIF) interactions in
ribosomal pre-initiation complexes is critical for the proper regulation of GCN4
mRNA translation in response to amino acid availability.
Sequence: PGGTRIIYDRKFLMECRNSP

Measles Virus Fusion Protein (288-302)- Cat# 62408
This peptide is amino acids 288 to 302 fragment of the measles virus fusion protein
(MV-F). This fragment of the fusion (F) protein represents a putative T cell
epitope. This sequence of the MV-F protein Tb is common for most MHC class II
including the mouse H2d haplotype.
Sequence: LSEIKGVIVHRLEGV

Influenza Virus Nucleoprotein (277-286)- Cat# 62422
This peptide is amino acids 277 to 286 fragment of the influenza virus nucleoprotein
(NP). The peptide shows a strong binding affinity to the I-Ab- influenza virus
protein.
Sequence: PACVYGPAVA

Company Info
AnaSpec, Inc. is a leading provider of integrated proteomics solutions to
pharmaceutical, biotech, and academic research institutions throughout the world.
With a vision for innovation through synergy, AnaSpec focuses on three core
technologies: peptides, detection reagents, and combinatorial chemistry.
Established in 1993, AnaSpec\'s headquarters and manufacturing facilities are located
in San Jose, CA.

For more information visit www.anaspec.com


Web Site: http://www.anaspec.com

Contact Details: 2149 O\'Toole Ave.
San Jose, CA 95131
ping@anaspec.com